PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf03311g00022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family CO-like
Protein Properties Length: 314aa    MW: 35282.4 Da    PI: 5.7811
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf03311g00022.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.55.5e-082570342
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                               ++C+ +e+ +++  C+ +   lC +C   +H+       H++ p+
  Peinf101Scf03311g00022.1 25 VWVCEVCEHAPASVTCKADAAALCVTCDHDIHSAnplarrHERLPI 70
                              689*****************************66888888998876 PP

2CCT706.1e-24251295145
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                               Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  Peinf101Scf03311g00022.1 251 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRNE 295
                               9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.7512370IPR000315B-box-type zinc finger
SMARTSM003361.1E-142370IPR000315B-box-type zinc finger
PfamPF006432.7E-62570IPR000315B-box-type zinc finger
CDDcd000214.95E-82670No hitNo description
PROSITE profilePS5101716.787251293IPR010402CCT domain
PfamPF062034.3E-18251293IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAFLCLGCDS KIHAANKLAS RHARVWVCEV CEHAPASVTC KADAAALCVT CDHDIHSANP  60
LARRHERLPI VPFYDSASAK SRAADETQQP ETEEEAEAES WLLQAPNTNN NIGFEGNEYN  120
KSAEYLFSDV DPYVDMEMIT DQKPCTDIQL HQEYKEADCV VPHVQNKNNN EMIHLQGPVV  180
DGYPTYHEMD FTGSKPFMYN FSTQSISQSV SSSSMEVGVV PDHNSMADVS NTFVRNSSTD  240
GLPTPVSSLD REARVLRYRE KRKNRKFEKT IRYASRKAYA ETRPRIKGRF AKRNEIEIDS  300
LIASEASYGV VPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604722.11e-178PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
RefseqXP_016495105.11e-178PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X1
RefseqXP_016495106.11e-178PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X2
SwissprotQ940T91e-88COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLK4CIE11e-162K4CIE1_SOLLC; Uncharacterized protein
STRINGSolyc08g006530.2.11e-161(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.14e-85CONSTANS-like 4